PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28211.m000132
Common NameLOC8266790, RCOM_0201150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 198aa    MW: 21786.4 Da    PI: 8.939
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28211.m000132genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.53.9e-4373149278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    Cqve+C adl++ak+yhrrhkvCe+h+kap+v+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a
  28211.m000132  73 CQVERCGADLTDAKRYHRRHKVCEIHAKAPAVVVAGLRQRFCQQCSRFHELVEFDEAKRSCRRRLAGHNERRRKSSA 149
                    **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.4E-3765134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.10370147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-4071151IPR004333Transcription factor, SBP-box
PfamPF031101.2E-3273146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MNANALGGKH SLREIAFVKD DCIVADELLD DDMEEEESGG SGVGFLDDEK KKVLHAKKGG  60
TSGGGGGGSP PSCQVERCGA DLTDAKRYHR RHKVCEIHAK APAVVVAGLR QRFCQQCSRF  120
HELVEFDEAK RSCRRRLAGH NERRRKSSAE SYGEGSSRKG PFSGQLKESH CRHVDERGKY  180
QITIPTAGSS AYKRSQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-3963146184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533086.11e-143PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ9S7581e-54SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLB9T4B71e-143B9T4B7_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0001s40870.11e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-52squamosa promoter binding protein-like 5